Web Analysis for Cssgrandfamilies - cssgrandfamilies.org
1.67
Rating by CuteStat
It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, cssgrandfamilies.org is SAFE to browse.
PageSpeed Score
68
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 184.175.95.2)
Family Law Attorney Services : Johnson Law
- familylawlawyerfayettevillenc.com
Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.
Not Applicable
$
8.95
Armando Luna - Technology Consultant | websites, hosting, custom softw
- coolmando.com
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Tue, 19 May 2015 22:55:06 GMT
Server: Apache mod_fcgid/2.3.9 mod_jk/1.2.37
Content-Length: 3388
Connection: close
Content-Type: text/html;charset=UTF-8
Date: Tue, 19 May 2015 22:55:06 GMT
Server: Apache mod_fcgid/2.3.9 mod_jk/1.2.37
Content-Length: 3388
Connection: close
Content-Type: text/html;charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns3.hostek.com | 173.245.58.12 | United States of America | |
ns4.hostek.com | 173.245.59.13 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
cssgrandfamilies.org | A | 14395 |
IP: 184.175.95.2 |
cssgrandfamilies.org | NS | 21599 |
Target: ns4.hostek.com |
cssgrandfamilies.org | NS | 21599 |
Target: ns3.hostek.com |
cssgrandfamilies.org | SOA | 21599 |
MNAME: ns3.hostek.com RNAME: cpanel.hostek.com Serial: 2015032503 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
cssgrandfamilies.org | MX | 14399 |
Target: cssgrandfamilies.org |
Full WHOIS Lookup
WHOIS LIMIT EXCEEDED - SEE WWW.PIR.ORG/WHOIS FOR DETAILS