1.67 Rating by CuteStat

It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, cssgrandfamilies.org is SAFE to browse.

PageSpeed Score
68
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.175.95.2

Hosted Country:

United States of America US

Location Latitude:

38.6312

Location Longitude:

-90.1922

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 184.175.95.2)

Family Law Attorney Services : Johnson Law

- familylawlawyerfayettevillenc.com

Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.

Not Applicable $ 8.95

403 Forbidden

- familylawattorneyfayettevillenc.com
Not Applicable $ 8.95

Error Occurred While Processing Request

- testosteronetherapyschertz.com
Not Applicable $ 8.95


Levitation Staging

- levquote.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Tue, 19 May 2015 22:55:06 GMT
Server: Apache mod_fcgid/2.3.9 mod_jk/1.2.37
Content-Length: 3388
Connection: close
Content-Type: text/html;charset=UTF-8

Domain Information

Domain Registrar: DropCatch.com 1498 LLC

Domain Nameserver Information

Host IP Address Country
ns3.hostek.com 173.245.58.12 United States of America United States of America
ns4.hostek.com 173.245.59.13 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
cssgrandfamilies.org A 14395 IP: 184.175.95.2
cssgrandfamilies.org NS 21599 Target: ns4.hostek.com
cssgrandfamilies.org NS 21599 Target: ns3.hostek.com
cssgrandfamilies.org SOA 21599 MNAME: ns3.hostek.com
RNAME: cpanel.hostek.com
Serial: 2015032503
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
cssgrandfamilies.org MX 14399 Target: cssgrandfamilies.org

Full WHOIS Lookup

WHOIS LIMIT EXCEEDED - SEE WWW.PIR.ORG/WHOIS FOR DETAILS